CDS

Accession Number TCMCG036C06425
gbkey CDS
Protein Id PTQ44414.1
Location join(829794..829795,830334..830424,831515..831604,831807..831839)
GeneID Phytozome:Mapoly0020s0072
Organism Marchantia polymorpha
locus_tag MARPO_0020s0072

Protein

Length 71aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA53523, BioSample:SAMN00769973
db_source KZ772692.1
Definition hypothetical protein MARPO_0020s0072 [Marchantia polymorpha]
Locus_tag MARPO_0020s0072

EGGNOG-MAPPER Annotation

COG_category C
Description This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1
KEGG_TC -
KEGG_Module M00152        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
KEGG_ko ko:K00416        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00190        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04260        [VIEW IN KEGG]
ko04714        [VIEW IN KEGG]
ko04932        [VIEW IN KEGG]
ko05010        [VIEW IN KEGG]
ko05012        [VIEW IN KEGG]
ko05016        [VIEW IN KEGG]
map00190        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04260        [VIEW IN KEGG]
map04714        [VIEW IN KEGG]
map04932        [VIEW IN KEGG]
map05010        [VIEW IN KEGG]
map05012        [VIEW IN KEGG]
map05016        [VIEW IN KEGG]
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005740        [VIEW IN EMBL-EBI]
GO:0005743        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0019866        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031966        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCGGACGATGCTGAAGATCCCGTCGATCCCAAGCCCGAAATTGAGGAGAATTGCAAACCCAAATGCGTGAAACAGCTTCTCCAATACCAGGCTTGTACCAAGCGGGTTGAAGACGATGATACGGGCTCAAAACATTGTACCGGTCAATACTTTGACTACTGGGGTTGCATTGACAAATGTGCTGCAACGAAGCTTTTTAACAAGCTGAAGTGA
Protein:  
MSDDAEDPVDPKPEIEENCKPKCVKQLLQYQACTKRVEDDDTGSKHCTGQYFDYWGCIDKCAATKLFNKLK